General Information

  • ID:  hor000280
  • Uniprot ID:  Q9CR53
  • Protein name:  Neuromedin-B
  • Gene name:  NMB
  • Organism:  Mus musculus (Mouse)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Up-regulated in lung tissue in response to infection with influenza A virus. |During osteoclast development, expression increases as the cells differentiate with high expression levels in mature osteoclasts (at protein level). |In the hindbrain, expressed
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031710 neuromedin B receptor binding
  • GO BP:  GO:0002376 immune system process; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008284 positive regulation of cell population proliferation; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0046887 positive regulation of hormone secretion; GO:0046888 negative regulation of hormone secretion; GO:0050482 arachidonic acid secretion; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  GNLWATGHFM
  • Length:  10(47-56)
  • Propeptide:  MTRQAGSSWLLRGLLLFALFASGVAPFNWDLPEPRSRASKIRVHPRGNLWATGHFMGKKSLEPPSLSLVGTAPPNTPRDQRLQLSHDLLRILLRKKALGMNFSGPAPPIQYRRLLEPLLQK
  • Signal peptide:  MTRQAGSSWLLRGLLLFALFASGV
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  has a role in food intake, circadian rhythm generation, fear memory, itch sensation and sexual behaviour
  • Mechanism:  Influence the Activity of Myometrial Primary Cells in Vitro Through Regulation of Il6 Expression via the Rela/p65 Pathway in Mice
  • Cross BBB:  YES
  • Target:  Nmbr
  • Target Unid:  O54799
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10093-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P10093-F1.pdbhor000280_AF2.pdbhor000280_ESM.pdb

Physical Information

Mass: 129401 Formula: C52H72N14O13S
Absent amino acids: CDEIKPQRSVY Common amino acids: G
pI: 7.55 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: 12 Boman Index: 240
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 49
Instability Index: -970 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  22262690
  • Title:  Neuromedin B and Its Receptor Influence the Activity of Myometrial Primary Cells in Vitro Through Regulation of Il6 Expression via the Rela/p65 Pathway in Mice